PDB entry 1pma

View 1pma on RCSB PDB site
Description: proteasome from thermoplasma acidophilum
Class: protease
Keywords: protease, proteasome, hydrolase
Deposited on 1994-12-19, released 1996-06-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.221
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pma1_
  • Chain '2':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pma2_
  • Chain 'A':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmaa_
  • Chain 'B':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmab_
  • Chain 'C':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmac_
  • Chain 'D':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmad_
  • Chain 'E':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmae_
  • Chain 'F':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmaf_
  • Chain 'G':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmag_
  • Chain 'H':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmah_
  • Chain 'I':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmai_
  • Chain 'J':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmaj_
  • Chain 'K':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmak_
  • Chain 'L':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmal_
  • Chain 'M':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmam_
  • Chain 'N':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pman_
  • Chain 'O':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmao_
  • Chain 'P':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmap_
  • Chain 'Q':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmaq_
  • Chain 'R':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmar_
  • Chain 'S':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmas_
  • Chain 'T':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmat_
  • Chain 'U':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmau_
  • Chain 'V':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmav_
  • Chain 'W':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmaw_
  • Chain 'X':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmax_
  • Chain 'Y':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmay_
  • Chain 'Z':
    Compound: proteasome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pmaz_

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1pma1 (1:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pma1 (1:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1pma2 (2:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pma2 (2:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pmaA (A:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaA (A:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pmaB (B:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaB (B:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pmaC (C:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaC (C:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pmaD (D:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaD (D:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1pmaE (E:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaE (E:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1pmaF (F:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaF (F:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1pmaG (G:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaG (G:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1pmaH (H:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaH (H:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1pmaI (I:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaI (I:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1pmaJ (J:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaJ (J:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1pmaK (K:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaK (K:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1pmaL (L:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaL (L:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1pmaM (M:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaM (M:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1pmaN (N:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaN (N:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1pmaO (O:)
    mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
    qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
    qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
    kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaO (O:)
    tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
    yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
    gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
    gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1pmaP (P:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaP (P:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1pmaQ (Q:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaQ (Q:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1pmaR (R:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaR (R:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1pmaS (S:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaS (S:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1pmaT (T:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaT (T:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1pmaU (U:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaU (U:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1pmaV (V:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaV (V:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1pmaW (W:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaW (W:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1pmaX (X:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaX (X:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1pmaY (Y:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaY (Y:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1pmaZ (Z:)
    mnqtletgtttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgda
    qvlvrymkaelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfs
    idaaggsvediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggm
    idvavitrkdgyvqlptdqiesrirklglil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmaZ (Z:)
    tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
    aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
    ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
    kdgyvqlptdqiesrirklglil