PDB entry 1pm2

View 1pm2 on RCSB PDB site
Description: crystal structure of manganese substituted r2-d84e (d84e mutant of the r2 subunit of e. coli ribonucleotide reductase)
Class: oxidoreductase
Keywords: four-helix bundle, diiron center, OXIDOREDUCTASE
Deposited on 2003-06-09, released 2004-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonucleoside-diphosphate reductase 1 beta chain
    Species: Escherichia coli [TaxId:562]
    Gene: RIR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69924 (0-338)
      • engineered (83)
      • conflict (325)
    Domains in SCOPe 2.07: d1pm2a_
  • Chain 'B':
    Compound: Ribonucleoside-diphosphate reductase 1 beta chain
    Species: Escherichia coli [TaxId:562]
    Gene: RIR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69924 (0-338)
      • engineered (83)
      • conflict (325)
    Domains in SCOPe 2.07: d1pm2b_
  • Heterogens: MN, HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pm2A (A:)
    ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
    dyqalpehekhifisnlkyqtllesiqgrspnvallplisipeletwvetwafsetihsr
    sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
    tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
    hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
    kdilcqyveyitnirmqavgldlpfntrsnpipwintwl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pm2B (B:)
    ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
    dyqalpehekhifisnlkyqtllesiqgrspnvallplisipeletwvetwafsetihsr
    sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
    tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
    hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
    kdilcqyveyitnirmqavgldlpfntrsnpipwintwl