PDB entry 1pl8

View 1pl8 on RCSB PDB site
Description: human SDH/NAD+ complex
Deposited on 2003-06-07, released 2004-02-17
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-20, with a file datestamp of 2004-04-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pl8A (A:)
    aaaakpnnlslvvhgpgdlrlenypipepgpnevllrmhsvgicgsdvhyweygrignfi
    vkkpmvlgheasgtvekvgssvkhlkpgdrvaiepgaprendefckmgrynlspsiffca
    tppddgnlcrfykhnaafcyklpdnvtfeegalieplsvgihacrrggvtlghkvlvcga
    gpigmvtllvakamgaaqvvvtdlsatrlskakeigadlvlqiskespqeiarkvegqlg
    ckpevtiectgaeasiqagiyatrsggtlvlvglgsemttvpllhaairevdikgvfryc
    ntwpvaismlasksvnvkplvthrfplekaleafetfkkglglkimlkcdpsdqnp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pl8B (B:)
    aaaakpnnlslvvhgpgdlrlenypipepgpnevllrmhsvgicgsdvhyweygrignfi
    vkkpmvlgheasgtvekvgssvkhlkpgdrvaiepgaprendefckmgrynlspsiffca
    tppddgnlcrfykhnaafcyklpdnvtfeegalieplsvgihacrrggvtlghkvlvcga
    gpigmvtllvakamgaaqvvvtdlsatrlskakeigadlvlqiskespqeiarkvegqlg
    ckpevtiectgaeasiqagiyatrsggtlvlvglgsemttvpllhaairevdikgvfryc
    ntwpvaismlasksvnvkplvthrfplekaleafetfkkglglkimlkcdpsdqnp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pl8C (C:)
    aaaakpnnlslvvhgpgdlrlenypipepgpnevllrmhsvgicgsdvhyweygrignfi
    vkkpmvlgheasgtvekvgssvkhlkpgdrvaiepgaprendefckmgrynlspsiffca
    tppddgnlcrfykhnaafcyklpdnvtfeegalieplsvgihacrrggvtlghkvlvcga
    gpigmvtllvakamgaaqvvvtdlsatrlskakeigadlvlqiskespqeiarkvegqlg
    ckpevtiectgaeasiqagiyatrsggtlvlvglgsemttvpllhaairevdikgvfryc
    ntwpvaismlasksvnvkplvthrfplekaleafetfkkglglkimlkcdpsdqnp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pl8D (D:)
    aaaakpnnlslvvhgpgdlrlenypipepgpnevllrmhsvgicgsdvhyweygrignfi
    vkkpmvlgheasgtvekvgssvkhlkpgdrvaiepgaprendefckmgrynlspsiffca
    tppddgnlcrfykhnaafcyklpdnvtfeegalieplsvgihacrrggvtlghkvlvcga
    gpigmvtllvakamgaaqvvvtdlsatrlskakeigadlvlqiskespqeiarkvegqlg
    ckpevtiectgaeasiqagiyatrsggtlvlvglgsemttvpllhaairevdikgvfryc
    ntwpvaismlasksvnvkplvthrfplekaleafetfkkglglkimlkcdpsdqnp