PDB entry 1pl7

View 1pl7 on RCSB PDB site
Description: Human Sorbitol Dehydrogenase (apo)
Deposited on 2003-06-07, released 2004-02-17
The last revision prior to the SCOP 1.69 freeze date was dated 2004-04-20, with a file datestamp of 2004-04-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pl7A (A:)
    aaaakpnnlslvvhgpgdlrlenypipepgpnevllrmhsvgicgsdvhyweygrignfi
    vkkpmvlgheasgtvekvgssvkhlkpgdrvaiepgaprendefckmgrynlspsiffca
    tppddgnlcrfykhnaafcyklpdnvtfeegalieplsvgihacrrggvtlghkvlvcga
    gpigmvtllvakamgaaqvvvtdlsatrlskakeigadlvlqiskespqeiarkvegqlg
    ckpevtiectgaeasiqagiyatrsggtlvlvglgsemttvpllhaairevdikgvfryc
    ntwpvaismlasksvnvkplvthrfplekaleafetfkkglglkimlkcdpsdqnp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pl7B (B:)
    aaaakpnnlslvvhgpgdlrlenypipepgpnevllrmhsvgicgsdvhyweygrignfi
    vkkpmvlgheasgtvekvgssvkhlkpgdrvaiepgaprendefckmgrynlspsiffca
    tppddgnlcrfykhnaafcyklpdnvtfeegalieplsvgihacrrggvtlghkvlvcga
    gpigmvtllvakamgaaqvvvtdlsatrlskakeigadlvlqiskespqeiarkvegqlg
    ckpevtiectgaeasiqagiyatrsggtlvlvglgsemttvpllhaairevdikgvfryc
    ntwpvaismlasksvnvkplvthrfplekaleafetfkkglglkimlkcdpsdqnp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pl7C (C:)
    aaaakpnnlslvvhgpgdlrlenypipepgpnevllrmhsvgicgsdvhyweygrignfi
    vkkpmvlgheasgtvekvgssvkhlkpgdrvaiepgaprendefckmgrynlspsiffca
    tppddgnlcrfykhnaafcyklpdnvtfeegalieplsvgihacrrggvtlghkvlvcga
    gpigmvtllvakamgaaqvvvtdlsatrlskakeigadlvlqiskespqeiarkvegqlg
    ckpevtiectgaeasiqagiyatrsggtlvlvglgsemttvpllhaairevdikgvfryc
    ntwpvaismlasksvnvkplvthrfplekaleafetfkkglglkimlkcdpsdqnp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pl7D (D:)
    aaaakpnnlslvvhgpgdlrlenypipepgpnevllrmhsvgicgsdvhyweygrignfi
    vkkpmvlgheasgtvekvgssvkhlkpgdrvaiepgaprendefckmgrynlspsiffca
    tppddgnlcrfykhnaafcyklpdnvtfeegalieplsvgihacrrggvtlghkvlvcga
    gpigmvtllvakamgaaqvvvtdlsatrlskakeigadlvlqiskespqeiarkvegqlg
    ckpevtiectgaeasiqagiyatrsggtlvlvglgsemttvpllhaairevdikgvfryc
    ntwpvaismlasksvnvkplvthrfplekaleafetfkkglglkimlkcdpsdqnp