PDB entry 1pl7

View 1pl7 on RCSB PDB site
Description: Human Sorbitol Dehydrogenase (apo)
Class: oxidoreductase
Keywords: human sorbitol dehydrogenase, OXIDOREDUCTASE
Deposited on 2003-06-07, released 2004-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sorbitol dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00796 (0-355)
      • see remark 999 (237)
    Domains in SCOPe 2.07: d1pl7a1, d1pl7a2
  • Chain 'B':
    Compound: sorbitol dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00796 (0-355)
      • see remark 999 (237)
    Domains in SCOPe 2.07: d1pl7b1, d1pl7b2
  • Chain 'C':
    Compound: sorbitol dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00796 (0-355)
      • see remark 999 (237)
    Domains in SCOPe 2.07: d1pl7c1, d1pl7c2
  • Chain 'D':
    Compound: sorbitol dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00796 (0-355)
      • see remark 999 (237)
    Domains in SCOPe 2.07: d1pl7d1, d1pl7d2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pl7A (A:)
    aaaakpnnlslvvhgpgdlrlenypipepgpnevllrmhsvgicgsdvhyweygrignfi
    vkkpmvlgheasgtvekvgssvkhlkpgdrvaiepgaprendefckmgrynlspsiffca
    tppddgnlcrfykhnaafcyklpdnvtfeegalieplsvgihacrrggvtlghkvlvcga
    gpigmvtllvakamgaaqvvvtdlsatrlskakeigadlvlqiskespqeiarkvegqlg
    ckpevtiectgaeasiqagiyatrsggtlvlvglgsemttvpllhaairevdikgvfryc
    ntwpvaismlasksvnvkplvthrfplekaleafetfkkglglkimlkcdpsdqnp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pl7B (B:)
    aaaakpnnlslvvhgpgdlrlenypipepgpnevllrmhsvgicgsdvhyweygrignfi
    vkkpmvlgheasgtvekvgssvkhlkpgdrvaiepgaprendefckmgrynlspsiffca
    tppddgnlcrfykhnaafcyklpdnvtfeegalieplsvgihacrrggvtlghkvlvcga
    gpigmvtllvakamgaaqvvvtdlsatrlskakeigadlvlqiskespqeiarkvegqlg
    ckpevtiectgaeasiqagiyatrsggtlvlvglgsemttvpllhaairevdikgvfryc
    ntwpvaismlasksvnvkplvthrfplekaleafetfkkglglkimlkcdpsdqnp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pl7C (C:)
    aaaakpnnlslvvhgpgdlrlenypipepgpnevllrmhsvgicgsdvhyweygrignfi
    vkkpmvlgheasgtvekvgssvkhlkpgdrvaiepgaprendefckmgrynlspsiffca
    tppddgnlcrfykhnaafcyklpdnvtfeegalieplsvgihacrrggvtlghkvlvcga
    gpigmvtllvakamgaaqvvvtdlsatrlskakeigadlvlqiskespqeiarkvegqlg
    ckpevtiectgaeasiqagiyatrsggtlvlvglgsemttvpllhaairevdikgvfryc
    ntwpvaismlasksvnvkplvthrfplekaleafetfkkglglkimlkcdpsdqnp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pl7D (D:)
    aaaakpnnlslvvhgpgdlrlenypipepgpnevllrmhsvgicgsdvhyweygrignfi
    vkkpmvlgheasgtvekvgssvkhlkpgdrvaiepgaprendefckmgrynlspsiffca
    tppddgnlcrfykhnaafcyklpdnvtfeegalieplsvgihacrrggvtlghkvlvcga
    gpigmvtllvakamgaaqvvvtdlsatrlskakeigadlvlqiskespqeiarkvegqlg
    ckpevtiectgaeasiqagiyatrsggtlvlvglgsemttvpllhaairevdikgvfryc
    ntwpvaismlasksvnvkplvthrfplekaleafetfkkglglkimlkcdpsdqnp