PDB entry 1pl6

View 1pl6 on RCSB PDB site
Description: Human SDH/NADH/inhibitor complex
Class: oxidoreductase
Keywords: sorbitol dehydrogenase, CP-166,572, OXIDOREDUCTASE
Deposited on 2003-06-07, released 2004-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sorbitol dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00796 (0-355)
      • modified residue (37)
      • modified residue (64)
      • modified residue (106)
      • modified residue (184)
      • modified residue (193)
      • see remark 999 (237)
      • modified residue (277)
      • modified residue (308)
      • modified residue (345)
    Domains in SCOPe 2.07: d1pl6a1, d1pl6a2
  • Chain 'B':
    Compound: sorbitol dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00796 (0-355)
      • modified residue (37)
      • modified residue (64)
      • modified residue (106)
      • modified residue (184)
      • modified residue (193)
      • see remark 999 (237)
      • modified residue (277)
      • modified residue (308)
      • modified residue (345)
    Domains in SCOPe 2.07: d1pl6b1, d1pl6b2
  • Chain 'C':
    Compound: sorbitol dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00796 (0-355)
      • modified residue (37)
      • modified residue (64)
      • modified residue (106)
      • modified residue (184)
      • modified residue (193)
      • see remark 999 (237)
      • modified residue (277)
      • modified residue (308)
      • modified residue (345)
    Domains in SCOPe 2.07: d1pl6c1, d1pl6c2
  • Chain 'D':
    Compound: sorbitol dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00796 (0-355)
      • modified residue (37)
      • modified residue (64)
      • modified residue (106)
      • modified residue (184)
      • modified residue (193)
      • see remark 999 (237)
      • modified residue (277)
      • modified residue (308)
      • modified residue (345)
    Domains in SCOPe 2.07: d1pl6d1, d1pl6d2
  • Heterogens: ZN, NAD, 572, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pl6A (A:)
    aaaakpnnlslvvhgpgdlrlenypipepgpnevllrmhsvgicgsdvhyweygrignfi
    vkkpmvlgheasgtvekvgssvkhlkpgdrvaiepgaprendefckmgrynlspsiffca
    tppddgnlcrfykhnaafcyklpdnvtfeegalieplsvgihacrrggvtlghkvlvcga
    gpigmvtllvakamgaaqvvvtdlsatrlskakeigadlvlqiskespqeiarkvegqlg
    ckpevtiectgaeasiqagiyatrsggtlvlvglgsemttvpllhaairevdikgvfryc
    ntwpvaismlasksvnvkplvthrfplekaleafetfkkglglkimlkcdpsdqnp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pl6B (B:)
    aaaakpnnlslvvhgpgdlrlenypipepgpnevllrmhsvgicgsdvhyweygrignfi
    vkkpmvlgheasgtvekvgssvkhlkpgdrvaiepgaprendefckmgrynlspsiffca
    tppddgnlcrfykhnaafcyklpdnvtfeegalieplsvgihacrrggvtlghkvlvcga
    gpigmvtllvakamgaaqvvvtdlsatrlskakeigadlvlqiskespqeiarkvegqlg
    ckpevtiectgaeasiqagiyatrsggtlvlvglgsemttvpllhaairevdikgvfryc
    ntwpvaismlasksvnvkplvthrfplekaleafetfkkglglkimlkcdpsdqnp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pl6C (C:)
    aaaakpnnlslvvhgpgdlrlenypipepgpnevllrmhsvgicgsdvhyweygrignfi
    vkkpmvlgheasgtvekvgssvkhlkpgdrvaiepgaprendefckmgrynlspsiffca
    tppddgnlcrfykhnaafcyklpdnvtfeegalieplsvgihacrrggvtlghkvlvcga
    gpigmvtllvakamgaaqvvvtdlsatrlskakeigadlvlqiskespqeiarkvegqlg
    ckpevtiectgaeasiqagiyatrsggtlvlvglgsemttvpllhaairevdikgvfryc
    ntwpvaismlasksvnvkplvthrfplekaleafetfkkglglkimlkcdpsdqnp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pl6D (D:)
    aaaakpnnlslvvhgpgdlrlenypipepgpnevllrmhsvgicgsdvhyweygrignfi
    vkkpmvlgheasgtvekvgssvkhlkpgdrvaiepgaprendefckmgrynlspsiffca
    tppddgnlcrfykhnaafcyklpdnvtfeegalieplsvgihacrrggvtlghkvlvcga
    gpigmvtllvakamgaaqvvvtdlsatrlskakeigadlvlqiskespqeiarkvegqlg
    ckpevtiectgaeasiqagiyatrsggtlvlvglgsemttvpllhaairevdikgvfryc
    ntwpvaismlasksvnvkplvthrfplekaleafetfkkglglkimlkcdpsdqnp