PDB entry 1pkr

View 1pkr on RCSB PDB site
Description: the structure of recombinant plasminogen kringle 1 and the fibrin binding site
Deposited on 1993-08-03, released 1994-01-31
The last revision prior to the SCOP 1.59 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.48 Å
R-factor: 0.159
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1pkr__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pkr_ (-)
    ecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndpqg
    pwcyttdpekrydycdilec