PDB entry 1pkq

View 1pkq on RCSB PDB site
Description: Myelin Oligodendrocyte Glycoprotein-(8-18C5) Fab-complex
Deposited on 2003-06-06, released 2003-07-15
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-15, with a file datestamp of 2003-07-15.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.25
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pkqA (A:)
    mkqstialallpllftpvtkadieltqspsslavsagekvtmsckssqsllnsgnqknyl
    awyqqkpglppklliygastresgvpdrftgsgsgtdftltissvqaedlavyycqndhs
    ypltfgagtkleikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdna
    lqsgnsqesvteqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
    c
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkqA (A:)
    dieltqspsslavsagekvtmsckssqsllnsgnqknylawyqqkpglppklliygastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtkleikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pkqB (B:)
    mkktaiaiavalagfatvaqaevklhesgaglvkpgasveisckatgytfssfwiewvkq
    rpghglewigeilpgrgrtnynekfkgkatftaetssntaymqlssltsedsavyycatg
    ntmvnmpywgqgttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvsw
    nsgaltsgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    scsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkqB (B:)
    evklhesgaglvkpgasveisckatgytfssfwiewvkqrpghglewigeilpgrgrtny
    nekfkgkatftaetssntaymqlssltsedsavyycatgntmvnmpywgqgttvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1pkqE (E:)
    mrgsgqfrvigpghpiralvgdeaelpcrispgknatgmevgwyrspfsrvvhlyrngkd
    qdaeqapeyrgrtellkesigegkvalriqnvrfsdeggytcffrdhsyqeeaavelkve
    dpfywinpgrsrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkqE (E:)
    gsgqfrvigpghpiralvgdeaelpcrispgknatgmevgwyrspfsrvvhlyrngkdqd
    aeqapeyrgrtellkesigegkvalriqnvrfsdeggytcffrdhsyqeeaavelkvedp
    f
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1pkqF (F:)
    mkqstialallpllftpvtkadieltqspsslavsagekvtmsckssqsllnsgnqknyl
    awyqqkpglppklliygastresgvpdrftgsgsgtdftltissvqaedlavyycqndhs
    ypltfgagtkleikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdna
    lqsgnsqesvteqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
    c
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkqF (F:)
    dieltqspsslavsagekvtmsckssqsllnsgnqknylawyqqkpglppklliygastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtkleikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1pkqG (G:)
    mkktaiaiavalagfatvaqaevklhesgaglvkpgasveisckatgytfssfwiewvkq
    rpghglewigeilpgrgrtnynekfkgkatftaetssntaymqlssltsedsavyycatg
    ntmvnmpywgqgttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvsw
    nsgaltsgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    scsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkqG (G:)
    evklhesgaglvkpgasveisckatgytfssfwiewvkqrpghglewigeilpgrgrtny
    nekfkgkatftaetssntaymqlssltsedsavyycatgntmvnmpywgqgttvtvssas
    tkgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1pkqJ (J:)
    mrgsgqfrvigpghpiralvgdeaelpcrispgknatgmevgwyrspfsrvvhlyrngkd
    qdaeqapeyrgrtellkesigegkvalriqnvrfsdeggytcffrdhsyqeeaavelkve
    dpfywinpgrsrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkqJ (J:)
    gqfrvigpghpiralvgdeaelpcrispgknatgmevgwyrspfsrvvhlyrngkdqdae
    qapeyrgrtellkesigegkvalriqnvrfsdeggytcffrdhsyqeeaavelkvedp