PDB entry 1pkm

View 1pkm on RCSB PDB site
Description: the refined three-dimensional structure of cat muscle (m1) pyruvate kinase, at a resolution of 2.6 angstroms
Deposited on 1995-07-13, released 1995-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.175
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pkm_ (-)
    iqtqqlhaamadtflehmcrldidsppitarntgiictigpasrsveilkemiksgmnva
    rlnfshgtheyhaetiknvraatesfasdpiryrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenvlwldyknickvvevgskvyvddglisllvkekgadf
    lvtevenggslgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkasdvh
    evrkvlgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    migrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelvrgsshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkhgdvvivltgwrpgsgftntmrvvpvp