PDB entry 1pk4

View 1pk4 on RCSB PDB site
Description: crystal and molecular structure of human plasminogen kringle 4 refined at 1.9-angstroms resolution
Deposited on 1991-07-18, released 1993-10-31
The last revision prior to the SCOP 1.61 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.142
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d1pk4__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pk4_ (-)
  dcyhgdgqsyrgtssttttgkkcqswssmtphrhqktpenypnagltmnycrnpdadkgp
  wcfttdpsvrweycnlkkc