PDB entry 1pk1

View 1pk1 on RCSB PDB site
Description: Hetero SAM domain structure of Ph and Scm.
Class: transcription repression
Keywords: Hetero SAM domain, polymers, transcriptional repression
Deposited on 2003-06-04, released 2005-02-15
The last revision prior to the SCOP 1.75 freeze date was dated 2005-02-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.233
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyhomeotic-proximal chromatin protein
    Species: Drosophila melanogaster
    Gene: PH-P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39769
      • modified residue (60)
      • modified residue (62)
      • engineered (68)
    Domains in SCOP 1.75: d1pk1a1
  • Chain 'B':
    Compound: Sex comb on midleg CG9495-PA
    Species: Drosophila melanogaster
    Gene: Sex Comb on Midleg
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VHA0
      • engineered (51)
      • engineered (56)
    Domains in SCOP 1.75: d1pk1b1
  • Chain 'C':
    Compound: Polyhomeotic-proximal chromatin protein
    Species: Drosophila melanogaster
    Gene: PH-P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39769
      • modified residue (60)
      • modified residue (62)
      • engineered (68)
    Domains in SCOP 1.75: d1pk1c1
  • Chain 'D':
    Compound: Sex comb on midleg CG9495-PA
    Species: Drosophila melanogaster
    Gene: Sex Comb on Midleg
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VHA0
      • engineered (51)
      • engineered (56)
    Domains in SCOP 1.75: d1pk1d1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pk1A (A:)
    mektrvngtdrppisswsvddvsnfirelpgcqdyvddfiqqeidgqallllkekhlvna
    mgmklgparkivakvesikevrdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pk1A (A:)
    ppisswsvddvsnfirelpgcqdyvddfiqqeidgqallllkekhlvnamgmklgparki
    vakvesik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pk1B (B:)
    mektranshlrsqpidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsermmk
    ymglklgpalkicnlvnkvngrdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pk1B (B:)
    rsqpidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsermmkymglklgpal
    kicnlvnkvn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pk1C (C:)
    mektrvngtdrppisswsvddvsnfirelpgcqdyvddfiqqeidgqallllkekhlvna
    mgmklgparkivakvesikevrdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pk1C (C:)
    pisswsvddvsnfirelpgcqdyvddfiqqeidgqallllkekhlvnamgmklgparkiv
    akvesi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pk1D (D:)
    mektranshlrsqpidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsermmk
    ymglklgpalkicnlvnkvngrdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pk1D (D:)
    pidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsermmkymglklgpalkic
    nlvnkvn