PDB entry 1pjw

View 1pjw on RCSB PDB site
Description: solution structure of the domain iii of the japan encephalitis virus envelope protein
Deposited on 2003-06-04, released 2003-11-25
The last revision prior to the SCOP 1.69 freeze date was dated 2003-11-25, with a file datestamp of 2003-11-25.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1pjwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pjwA (A:)
    dklalkgttygmctekfsfaknpadtghgtvvielsysgsdgpckipivsvaslndmtpv
    grlvtvnpfvatssanskvlvemeppfgdsyivvgmgdkqinhhwhkagst