PDB entry 1pjf

View 1pjf on RCSB PDB site
Description: Solid State NMR structure of the Pf1 Major Coat Protein in Magnetically Aligned Bacteriophage
Class: viral protein
Keywords: Viral protein, Helical virus
Deposited on 2003-06-02, released 2004-08-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: SOLID-STATENMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coat protein b
    Species: Pseudomonas phage Pf1 [TaxId:10871]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pjfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pjfA (A:)
    gvidtsavesaitdgqgdmkaiggyivgalvilavagliysmlrka