PDB entry 1pjc

View 1pjc on RCSB PDB site
Description: l-alanine dehydrogenase complexed with nad
Deposited on 1998-06-05, released 1999-07-15
The last revision prior to the SCOP 1.63 freeze date was dated 1999-07-15, with a file datestamp of 1999-07-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pjcA (A:)
    meigvpkeiknqefrvglspssvrtlveaghtvfietqagigagfadqdyvqagaqvvps
    akdawsremvvkvkeplpaeydlmqkdqllftylhlaaarelteqlmrvgltaiayetve
    lpnrslplltpmsiiagrlsvqfgarflerqqggrgvllggvpgvkpgkvvilgggvvgt
    eaakmavglgaqvqifdinverlsyletlfgsrvellysnsaeietavaeadlligavlv
    pgrrapilvpaslveqmrtgsvivdvavdqggcvetlhptshtqptyevfgvvhygvpnm
    pgavpwtatqalnnstlpyvvklanqglkaletddalakglnvqahrlvhpavqqvfpdl
    a