PDB entry 1pjb

View 1pjb on RCSB PDB site
Description: l-alanine dehydrogenase
Deposited on 1998-06-05, released 1999-06-08
The last revision prior to the SCOP 1.63 freeze date was dated 1999-06-08, with a file datestamp of 1999-06-07.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pjbA (A:)
    meigvpkeiknqefrvglspssvrtlveaghtvfietqagigagfadqdyvqagaqvvps
    akdawsremvvkvkeplpaeydlmqkdqllftylhlaaarelteqlmrvgltaiayetve
    lpnrslplltpmsiiagrlsvqfgarflerqqggrgvllggvpgvkpgkvvilgggvvgt
    eaakmavglgaqvqifdinverlsyletlfgsrvellysnsaeietavaeadlligavlv
    pgrrapilvpaslveqmrtgsvivdvavdqggcvetlhptshtqptyevfgvvhygvpnm
    pgavpwtatqalnnstlpyvvklanqglkaletddalakglnvqahrlvhpavqqvfpdl
    a