PDB entry 1pj9

View 1pj9 on RCSB PDB site
Description: bacillus circulans strain 251 loop mutant 183-195
Deposited on 2003-06-02, released 2004-02-03
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-03, with a file datestamp of 2004-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.152
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pj9A (A:)
    apdtsvsnkqnfstdviyqifndrfsdgnpannptgaafdgtctnlrlycggdwqgiink
    indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
    liaaahaknikviidfapnhtspassdqpsfaengrlydngtllggytndtqnlfhhngg
    tdfssyedgiyrnlydladlnhnnstvdvylkdaikmwldlgidgirmdavkhmpfgwqk
    sfmaavnnykpvftfgewflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
    yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
    gteqymsggtdpdnraripsfststtayqviqklaplrksnpaiaygstqerwinndvli
    yerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllngntlsvgsggaasnf
    tlaaggtavwqytaatatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgad
    itswedtqikvkipavaggnynikvanaagtasnvydnfevlsgdqvsvrfvvnnattal
    gqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvsvpagktiefkflkkqgstv
    tweggsnhtftapssgtatinvnwqp