PDB entry 1pim

View 1pim on RCSB PDB site
Description: dithionite reduced e. coli ribonucleotide reductase r2 subunit, d84e mutant
Class: oxidoreductase
Keywords: four-helix bundle, diiron cluster, diferrous cluster, OXIDOREDUCTASE
Deposited on 2003-05-30, released 2003-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonucleoside-diphosphate reductase 1 beta chain
    Species: Escherichia coli [TaxId:562]
    Gene: RIR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69924 (0-End)
      • engineered (83)
      • see remark 999 (325)
    Domains in SCOPe 2.07: d1pima_
  • Chain 'B':
    Compound: Ribonucleoside-diphosphate reductase 1 beta chain
    Species: Escherichia coli [TaxId:562]
    Gene: RIR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69924 (0-End)
      • engineered (83)
      • see remark 999 (325)
    Domains in SCOPe 2.07: d1pimb_
  • Heterogens: FE, HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pimA (A:)
    ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
    dyqalpehekhifisnlkyqtllesiqgrspnvallplisipeletwvetwafsetihsr
    sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
    tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
    hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
    kdilcqyveyitnirmqavgldlpfntrsnpipwintwlvsdnvqvapqevevssylvgq
    idsevdtddlsnfql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pimA (A:)
    ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
    dyqalpehekhifisnlkyqtllesiqgrspnvallplisipeletwvetwafsetihsr
    sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
    tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
    hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
    kdilcqyveyitnirmqavgldlpfntrsnpipwintwlv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pimB (B:)
    ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
    dyqalpehekhifisnlkyqtllesiqgrspnvallplisipeletwvetwafsetihsr
    sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
    tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
    hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
    kdilcqyveyitnirmqavgldlpfntrsnpipwintwlvsdnvqvapqevevssylvgq
    idsevdtddlsnfql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pimB (B:)
    ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
    dyqalpehekhifisnlkyqtllesiqgrspnvallplisipeletwvetwafsetihsr
    sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
    tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
    hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
    kdilcqyveyitnirmqavgldlpfntrsnpipwintwlv