PDB entry 1pic

View 1pic on RCSB PDB site
Description: phosphatidylinositol 3-kinase, p85-alpha subunit: c-terminal sh2 domain complexed with a tyr751 phosphopeptide from the pdgf receptor, nmr, minimized mean structure
Class: complex (phosphotransferase/receptor)
Keywords: phosphotransferase, sh2 domain, signal transduction, phosphoinositide 3-kinase, complex (phosphotransferase/receptor)
Deposited on 1997-06-23, released 1997-09-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol 3-kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1pica_
  • Chain 'B':
    Compound: beta-platelet-derived growth factor receptor
    Database cross-references and differences (RAF-indexed):
    • PDB 1PIC (Start-4)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1picA (A:)
    gspiphhdektwnvgssnrnkaenllrgkrdgtflvresskqgcyacsvvvdgevkhcvi
    nktatgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvyaqqrr
    

  • Chain 'B':
    No sequence available.