PDB entry 1pic

View 1pic on RCSB PDB site
Description: phosphatidylinositol 3-kinase, p85-alpha subunit: c-terminal sh2 domain complexed with a tyr751 phosphopeptide from the pdgf receptor, nmr, minimized mean structure
Deposited on 1997-06-23, released 1997-09-17
The last revision prior to the SCOP 1.57 freeze date was dated 1997-09-17, with a file datestamp of 1997-09-17.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1pica_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1picA (A:)
    gspiphhdektwnvgssnrnkaenllrgkrdgtflvresskqgcyacsvvvdgevkhcvi
    nktatgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvyaqqrr