PDB entry 1pi6

View 1pi6 on RCSB PDB site
Description: YEAST ACTIN INTERACTING PROTEIN 1 (Aip1), ORTHORHOMBIC CRYSTAL FORM
Class: protein binding
Keywords: WD repeat, beta-propeller, PROTEIN BINDING
Deposited on 2003-05-29, released 2003-07-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.219
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin interacting protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: AIP1 OR YMR092C OR YM9582.17C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46680
      • engineered (529)
    Domains in SCOPe 2.03: d1pi6a1, d1pi6a2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pi6A (A:)
    mssislkeiippqpstqrnftthlsydpttnaiaypcgksafvrclddgdskvppvvqft
    ghgssvvttvkfspikgsqylcsgdesgkvivwgwtfdkesnsvevnvksefqvlagpis
    diswdfegrrlcvvgegrdnfgvfiswdsgnslgevsghsqrinachlkqsrpmrsmtvg
    ddgsvvfyqgppfkfsasdrthhkqgsfvrdvefspdsgefvitvgsdrkiscfdgksge
    flkyieddqepvqggifalswldsqkfatvgadatirvwdvttskcvqkwtldkqqlgnq
    qvgvvatgngriislsldgtlnfyelghdevlktisghnkgitaltvnplisgsydgrim
    ewssssmhqdhsnlivsldnskaqeyssiswddtlkvngitkhefgsqpkvasanndgft
    avltndddllilqsftgdiiksvrlnspgsavslsqnyvavgleegntiqvfklsdlevs
    fdlktplrakpsyisispsetyiaagdvmgkillydlqsrevktsrwafrtskinaiswk
    paekganeeeieedlvatgsldtnifiysvkrpmkiikalnahkdgvnnllwetpstlvs
    sgadacikrwnvvle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pi6A (A:)
    ssislkeiippqpstqrnftthlsydpttnaiaypcgksafvrclddgdskvppvvqftg
    hgssvvttvkfspikgsqylcsgdesgkvivwgwtfdkesnsvevnvksefqvlagpisd
    iswdfegrrlcvvgegrdnfgvfiswdsgnslgevsghsqrinachlkqsrpmrsmtvgd
    dgsvvfyqgppfkfsasdrthhkqgsfvrdvefspdsgefvitvgsdrkiscfdgksgef
    lkyieddqepvqggifalswldsqkfatvgadatirvwdvttskcvqkwtldkqqlgnqq
    vgvvatgngriislsldgtlnfyelghdevlktisghnkgitaltvnplisgsydgrime
    wssssmhqdhsnlivsldnskaqeyssiswddtlkvngitkhefgsqpkvasanndgfta
    vltndddllilqsftgdiiksvrlnspgsavslsqnyvavgleegntiqvfklsdlevsf
    dlktplrakpsyisispsetyiaagdvmgkillydlqsrevktsrwafrtskinaiswkp
    aeeieedlvatgsldtnifiysvkrpmkiikalnahkdgvnnllwetpstlvssgadaci
    krwnvv