PDB entry 1pi5

View 1pi5 on RCSB PDB site
Description: Structure of N289A mutant of AmpC in complex with SM2, carboxyphenylglycylboronic acid bearing the cephalothin R1 side chain
Class: hydrolase
Keywords: Crystal structure, Enzyme Inhibitor Complex, Beta-Lactamase
Deposited on 2003-05-29, released 2004-02-24
The last revision prior to the SCOP 1.75 freeze date was dated 2004-02-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.155
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli
    Gene: AMPC OR AMPA OR B4150
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00811 (0-357)
      • engineered (285)
    Domains in SCOP 1.75: d1pi5a_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Escherichia coli
    Gene: AMPC OR AMPA OR B4150
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00811 (0-357)
      • engineered (285)
    Domains in SCOP 1.75: d1pi5b_
  • Heterogens: PO4, K, SM2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pi5A (A:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdakialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pi5B (B:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdakialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq