PDB entry 1phs

View 1phs on RCSB PDB site
Description: the three-dimensional structure of the seed storage protein phaseolin at 3 angstroms resolution
Class: plant seed storage protein (vicilin)
Keywords: plant seed storage protein (vicilin)
Deposited on 1990-03-21, released 1990-10-15
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 3 Å
R-factor: 0.225
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phaseolin, beta-type precursor
    Species: Phaseolus vulgaris
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1phsa1, d1phsa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1phsA (A:)
    tslreeeesqdnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrsk
    petlllpqqadaelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifyl
    vnpdpkedlriiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrv
    lfeeegqqegvivnidseqikelskhaksssrkslskqdntignefgnltertdnslnvl
    issiemeegalfvphyyskaivilvvnegeahvelvgpkgnketleyesyraelskddvf
    vipaaypvaikatsnvnftgfginannnnrnllagktdnvissigraldgkdvlgltfsg
    sgdevmklinkqsgsyfvdahhhqqeqqkgrkgafvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1phsA (A:)
    dnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrskpetlllpqqa
    daelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifylvnpdpkedlr
    iiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrvlfeeegqqeg
    vivnidseqikelskhaksssrntignefgnltertdnslnvlissiemeegalfvphyy
    skaivilvvnegeahvelvgpkgnketleyesyraelskddvfvipaaypvaikatsnvn
    ftgfginannnnrnllagktdnvissigraldgkdvlgltfsgsgdevmklinkqsgsyf
    vdah