PDB entry 1phs

View 1phs on RCSB PDB site
Description:
Deposited on 1990-03-21, released 1990-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1990-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 3 Å
R-factor: 0.225
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1phs_1, d1phs_2

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1phs_ (-)
    dnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrskpetlllpqqa
    daelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifylvnpdpkedlr
    iiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrvlfeeegqqeg
    vivnidseqikelskhaksssrkslskqdntignefgnltertdnslnvlissiemeega
    lfvphyyskaivilvvnegeahvelvgpkgnketleyesyraelskddvfvipaaypvai
    katsnvnftgfginannnnrnllagktdnvissigraldgkdvlgltfsgsgdevmklin
    kqsgsyfvdah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1phs_ (-)
    dnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrskpetlllpqqa
    daelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifylvnpdpkedlr
    iiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrvlfeeegqqeg
    vivnidseqikelskhaksssrntignefgnltertdnslnvlissiemeegalfvphyy
    skaivilvvnegeahvelvgpkgnketleyesyraelskddvfvipaaypvaikatsnvn
    ftgfginannnnrnllagktdnvissigraldgkdvlgltfsgsgdevmklinkqsgsyf
    vdah