PDB entry 1phn

View 1phn on RCSB PDB site
Description: structure of phycocyanin from cyanidium caldarium at 1.65a resolution
Class: electron transport
Keywords: phycocyanin, phycobilisome, electron transport
Deposited on 1995-06-21, released 1997-09-17
The last revision prior to the SCOP 1.73 freeze date was dated 2003-09-30, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.183
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phycocyanin
    Species: Cyanidium caldarium
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1phna_
  • Chain 'B':
    Compound: phycocyanin
    Species: Cyanidium caldarium
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00311 (0-171)
      • conflict (71)
    Domains in SCOP 1.73: d1phnb_
  • Heterogens: CYC, PEB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1phnA (A:)
mktpiteaiaaadnqgrflsntelqavngryqraaasleaarsltsnaerlingaaqavy
skfpytsqmpgpqyassavgkakcardigyylrmvtyclvvggtgpmdeyliagleeinr
tfdlspswyvealnyikanhglsgqaaneantyidyainals

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1phnB (B:)
mldafakvvaqadargeflsntqldalskmvsegnkrldvvnritsnasaivtnaaralf
seqpqliqpggnaytnrrmaaclrdmeiilryvsyaiiagdssilddrclnglretyqal
gvpgasvavgiekmkdsaiaiandpsgittgdcsalmaevgtyfdraatavq