PDB entry 1phn

View 1phn on RCSB PDB site
Description: structure of phycocyanin from cyanidium caldarium at 1.65a resolution
Deposited on 1995-06-21, released 1997-09-17
The last revision prior to the SCOP 1.69 freeze date was dated 1997-09-17, with a file datestamp of 1997-09-17.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.183
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1phna_
  • Chain 'B':
    Domains in SCOP 1.69: d1phnb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1phnA (A:)
    mktpiteaiaaadnqgrflsntelqavngryqraaasleaarsltsnaerlingaaqavy
    skfpytsqmpgpqyassavgkakcardigyylrmvtyclvvggtgpmdeyliagleeinr
    tfdlspswyvealnyikanhglsgqaaneantyidyainals
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1phnB (B:)
    mldafakvvaqadargeflsntqldalskmvsegnkrldvvnritsnasaivtnaaralf
    seqpqliqpggnaytnrrmaaclrdmeiilryvsyaiiagdssilddrclnglretyqal
    gvpgasvavgiekmkdsaiaiandpsgittgdcsalmaevgtyfdraatavq