PDB entry 1phn

View 1phn on RCSB PDB site
Description: structure of phycocyanin from cyanidium caldarium at 1.65a resolution
Class: electron transport
Keywords: phycocyanin, phycobilisome, electron transport
Deposited on 1995-06-21, released 1997-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.183
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phycocyanin
    Species: Cyanidium caldarium [TaxId:2771]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1phna_
  • Chain 'B':
    Compound: phycocyanin
    Species: Cyanidium caldarium [TaxId:2771]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00311 (0-171)
      • conflict (71)
    Domains in SCOPe 2.07: d1phnb_
  • Heterogens: CYC, PEB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1phnA (A:)
    mktpiteaiaaadnqgrflsntelqavngryqraaasleaarsltsnaerlingaaqavy
    skfpytsqmpgpqyassavgkakcardigyylrmvtyclvvggtgpmdeyliagleeinr
    tfdlspswyvealnyikanhglsgqaaneantyidyainals
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1phnB (B:)
    mldafakvvaqadargeflsntqldalskmvsegnkrldvvnritsnasaivtnaaralf
    seqpqliqpggnaytnrrmaaclrdmeiilryvsyaiiagdssilddrclnglretyqal
    gvpgasvavgiekmkdsaiaiandpsgittgdcsalmaevgtyfdraatavq