PDB entry 1ph4

View 1ph4 on RCSB PDB site
Description: crystal structure of the oxytricha nova telomere end-binding protein complexed with noncognate ssdna ggggttttggcg
Deposited on 2003-05-29, released 2003-06-17
The last revision prior to the SCOP 1.69 freeze date was dated 2003-11-25, with a file datestamp of 2003-11-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.214
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ph4A (A:)
    yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagdas
    dyatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrs
    vtqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssysvissdmytaln
    kaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfphvrtgevvrirs
    atydetstqkkvlilshysniitfiqssklakelrakiqddhsvevaslkknvslnavvl
    tevdkkhaalpstslqdlfhhadsdkelqaqdtfrtqfyvtkiepsdvkewvkgydrktk
    kssslkgasgkgdnifqvqflvkdastqlnnntyrvllytqdglganffnvkadnlhkna
    darkkledsaelltkfnsyvdavverrngfylikdtkliy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ph4B (B:)
    qqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeav
    nefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqer
    lnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdag
    ivkasaskgdefsdfsfkegntatlkiadifvqekg