PDB entry 1pgx

View 1pgx on RCSB PDB site
Description: the 1.66 angstroms x-ray structure of the b2 immunoglobulin-binding domain of streptococcal protein g and comparison to the nmr structure of the b1 domain
Class: immunoglobulin binding protein
Keywords: immunoglobulin binding protein
Deposited on 1992-04-03, released 1992-07-15
The last revision prior to the SCOP 1.73 freeze date was dated 1992-07-15, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.66 Å
R-factor: 0.191
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein g
  Species: Streptococcus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06654
    • conflict (75)
  Domains in SCOP 1.73: d1pgxa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1pgxA (A:)
  mdpgdaseltpavttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtydd
  atktftvtemvtevpvaskrked
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1pgxA (A:)
  eltpavttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftv
  temvtevpva