PDB entry 1pgv

View 1pgv on RCSB PDB site
Description: structural genomics of caenorhabditis elegans: tropomodulin c-terminal domain
Deposited on 2003-05-28, released 2003-06-10
The last revision prior to the SCOP 1.71 freeze date was dated 2004-07-27, with a file datestamp of 2004-07-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.209
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1pgva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pgvA (A:)
    gshgttfngimqsyvprivpdepdndtdvescinrlreddtdlkevninnmkrvskerir
    slieaacnskhiekfslantaisdsearglielietspslrvlnvesnfltpellarllr
    stlvtqsivefkadnqrqsvlgnqvemdmmmaieenesllrvgisfasmearhrvseale
    rnyervrlrrlgkdpnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pgvA (A:)
    tdvescinrlreddtdlkevninnmkrvskerirslieaacnskhiekfslantaisdse
    arglielietspslrvlnvesnfltpellarllrstlvtqsivefkadnqrqsvlgnqve
    mdmmmaieenesllrvgisfasmearhrvsealernyervrlrrlgk