PDB entry 1pgt

View 1pgt on RCSB PDB site
Description: crystal structure of human glutathione s-transferase p1-1[v104] complexed with s-hexylglutathione
Deposited on 1997-02-17, released 1997-09-04
The last revision prior to the SCOP 1.61 freeze date was dated 1997-09-04, with a file datestamp of 1997-09-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pgtA (A:)
    mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgd
    ltlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyvsliytnyeagkddyv
    kalpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsay
    vgrlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pgtB (B:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyvsliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq