PDB entry 1pgr

View 1pgr on RCSB PDB site
Description: 2:2 complex of g-csf with its receptor
Class: cytokine
Keywords: class1 cytokine, hematopoietic receptor, signal transduction
Deposited on 1999-03-08, released 2000-03-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.317
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (granulocyte colony-stimulating factor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pgra_
  • Chain 'B':
    Compound: protein (g-csf receptor)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pgrb1, d1pgrb2
  • Chain 'C':
    Compound: protein (granulocyte colony-stimulating factor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pgrc_
  • Chain 'D':
    Compound: protein (g-csf receptor)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pgrd1, d1pgrd2
  • Chain 'E':
    Compound: protein (granulocyte colony-stimulating factor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pgre_
  • Chain 'F':
    Compound: protein (g-csf receptor)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pgrf1, d1pgrf2
  • Chain 'G':
    Compound: protein (granulocyte colony-stimulating factor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pgrg_
  • Chain 'H':
    Compound: protein (g-csf receptor)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pgrh1, d1pgrh2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pgrA (A:)
    mtplgpasslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwa
    plsscpsqalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwq
    qmeelgmapalqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pgrA (A:)
    asslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplsscp
    sqalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmeelg
    maampafasafqrraggvlvashlqsflevsyrvlrhlaqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pgrB (B:)
    agyppaspsnlsclmhlttnslvcqwepgpethlptsfilksfrsradcqyqgdtipdcv
    akkrqnncsiprknlllyqymaiwvqaenmlgssespklcldpmdvvkleppmlqaldig
    pdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvfhlpsskdqfelcglh
    qapvytlqmrcirsslpgfwspwspglqlrptmka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pgrB (B:)
    agyppaspsnlsclmhlttnslvcqwepgpethlptsfilksfrsradcqyqgdtipdcv
    akkrqnncsiprknlllyqymaiwvqaenmlgssespklcldpmdvkleppmlqaldigp
    dqpgclwlswkpwkpseymeqecelryqpqlkganwtlvfhlpsskdqfelcglhqapvy
    tlqmrcirsslpgfwspwspglqlrptm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pgrC (C:)
    mtplgpasslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwa
    plsscpsqalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwq
    qmeelgmapalqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pgrC (C:)
    sslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplsscps
    qlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmeelgmapa
    lqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pgrD (D:)
    agyppaspsnlsclmhlttnslvcqwepgpethlptsfilksfrsradcqyqgdtipdcv
    akkrqnncsiprknlllyqymaiwvqaenmlgssespklcldpmdvvkleppmlqaldig
    pdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvfhlpsskdqfelcglh
    qapvytlqmrcirsslpgfwspwspglqlrptmka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pgrD (D:)
    yppaspsnlsclmhlttnslvcqwepgpettsfilksfrsradcqyqgdtipdcvakkrq
    nncsiprknlllyqymaiwvqaenmlgssespklcldpmdvkleppmlqaldiqpgclwl
    swkpwkpseymeqecelryqpqlkganwtlvfhlpsskdqfelcglhqapvytlqmrcir
    sslpgfwspwspglqlrptm
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1pgrE (E:)
    mtplgpasslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwa
    plsscpsqalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwq
    qmeelgmapalqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pgrE (E:)
    gpasslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplss
    cpsqalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmee
    lgmaampafasafqrraggvlvashlqsflevsyrvlrhlaqp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1pgrF (F:)
    agyppaspsnlsclmhlttnslvcqwepgpethlptsfilksfrsradcqyqgdtipdcv
    akkrqnncsiprknlllyqymaiwvqaenmlgssespklcldpmdvvkleppmlqaldig
    pdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvfhlpsskdqfelcglh
    qapvytlqmrcirsslpgfwspwspglqlrptmka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pgrF (F:)
    agyppaspsnlsclmhlttnslvcqwepgpethlptsfilksfrsradcqyqgdtipdcv
    akkrqnncsiprknlllyqymaiwvqaenmlgssespklcldpmdvkleppmlqaldigp
    dhqpgclwlswkpwkpseymeqecelryqpqlkganwtlvfhlpsskdqfelcglhqapv
    ytlqmrcirsslpgfwspwspglqlrptm
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1pgrG (G:)
    mtplgpasslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwa
    plsscpsqalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwq
    qmeelgmapalqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pgrG (G:)
    sslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplsscps
    qlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmeelgmapa
    lqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1pgrH (H:)
    agyppaspsnlsclmhlttnslvcqwepgpethlptsfilksfrsradcqyqgdtipdcv
    akkrqnncsiprknlllyqymaiwvqaenmlgssespklcldpmdvvkleppmlqaldig
    pdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvfhlpsskdqfelcglh
    qapvytlqmrcirsslpgfwspwspglqlrptmka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pgrH (H:)
    yppaspsnlsclmhlttnslvcqwepgpettsfilksfrsradcqyqgdtipdcvakkrq
    nncsiprknlllyqymaiwvqaenmlgssespklcldpmdvkleppmlqaldiqpgclwl
    swkpwkpseymeqecelryqpqlkganwtlvfhlpsskdqfelcglhqapvytlqmrcir
    sslpgfwspwspglqlrptm