PDB entry 1pgb

View 1pgb on RCSB PDB site
Description: two crystal structures of the b1 immunoglobulin-binding domain of streptoccocal protein g and comparison with nmr
Class: immunoglobulin binding protein
Keywords: immunoglobulin binding protein
Deposited on 1993-11-23, released 1994-04-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.198
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein g
    Species: Streptococcus sp. GX7805 [TaxId:1325]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pgba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pgbA (A:)
    mtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte