PDB entry 1pga

View 1pga on RCSB PDB site
Description: two crystal structures of the b1 immunoglobulin-binding domain of streptococcal protein g and comparison with nmr
Class: immunoglobulin binding protein
Keywords: immunoglobulin binding protein
Deposited on 1993-11-23, released 1994-04-30
The last revision prior to the SCOP 1.73 freeze date was dated 1994-04-30, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.07 Å
R-factor: 0.174
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein g
    Species: Streptococcus sp. GX7805
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1pgaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pgaA (A:)
    mtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte