PDB entry 1pg0

View 1pg0 on RCSB PDB site
Description: Methionyl-trna synthetase from escherichia coli complexed with methioninyl adenylate
Class: ligase
Keywords: Rossmann fold, LIGASE
Deposited on 2003-05-27, released 2004-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.223
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionyl-tRNA synthetase
    Species: Escherichia coli [TaxId:562]
    Gene: metG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pg0a1, d1pg0a2
  • Heterogens: MOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pg0A (A:)
    tqvakkilvtcalpyangsihlghmlehiqadvwvryqrmrghevnficaddahgtpiml
    kaqqlgitpeqmigemsqehqtdfagfnisydnyhsthseenrqlseliysrlkengfik
    nrtisqlydpekgmflpdrfvkgtcpkckspdqygdncevcgatyspteliepksvvsga
    tpvmrdsehfffdlpsfsemlqawtrsgalqeqvankmqewfesglqqwdisrdapyfgf
    eipnapgkyfyvwldapigymgsfknlcdkrgdsvsfdeywkkdstaelyhfigkdivyf
    hslfwpamlegsnfrkpsnlfvhgyvtvngakmsksrgtfikastwlnhfdadslryyyt
    aklssriddidlnledfvqrvnadivnkvvnlasrnagfinkrfdgvlaseladpqlykt
    ftdaaevigeawesrefgkavreimaladlanryvdeqapwvvakqegrdadlqaicsmg
    inlfrvlmtylkpvlpklteraeaflnteltwdgiqqpllghkvnpfkalynridmrqve
    alveaskeevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pg0A (A:)
    akkilvtcalpyangsihlghmlehiqadvwvryqrmrghevnficaddahgtpimlkaq
    qlgitpeqmigemsqehqtdfagfnisydnyhsthseenrqlseliysrlkengfiknrt
    isqlydrdsehfffdlpsfsemlqawtrsgalqeqvankmqewfesglqqwdisrdapyf
    gfeipnapgkyfyvwldapigymgsfknlcdkrgdsvsfdeywkkdstaelyhfigkdiv
    yfhslfwpamlegsnfrkpsnlfvhgyvtvngakmsksrgtfikastwlnhfdadslryy
    ytaklssriddidlnledfvqrvnadivnkvvnlasrnagfinkrfdgvlaseladpqly
    ktftdaaevigeawesrefgkavreimaladlanryvdeqapwvvakqegrdadlqaics
    mginlfrvlmtylkpvlpklteraeaflnteltwdgiqqpllghkvnpfkalynridmrq
    vealveaskeev