PDB entry 1pfx

View 1pfx on RCSB PDB site
Description: porcine factor ixa
Deposited on 1995-07-19, released 1996-08-17
The last revision prior to the SCOP 1.57 freeze date was dated 1996-08-17, with a file datestamp of 1996-09-19.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.198
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pfxC (C:)
    ivggenakpgqfpwqvllngkidafcggsiinekwvvtaahciepgvkitvvageyntee
    tepteqrrnviraiphhsynatvnkyshdialleldepltlnsyvtpiciadkeytnifl
    kfgsgyvsgwgrvfnrgrsatilqylkvplvdratclrstkftiysnmfcagfheggkds
    cqgdsggphvtevegtsfltgiiswgeecavkgkygiytkvsryvnwikektklt
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1pfxL (L:)
    ynsgkleefvrgnlerecieekcsfeearevfentektnefwkqyvdgdqcepnpclngg
    lckxdinsyecwcqvgfegknceldatcnikngrckqfcktgadskvlcscttgyrlapd
    qksckpavpfpcgrvsvshspttltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pfxL (L:)
    ynsgkleefvrgnlerecieekcsfeearevfentektnefwkqyvdgdqcepnpclngg
    lckdinsyecwcqvgfegknceldatcnikngrckqfcktgadskvlcscttgyrlapdq
    ksckpavpfpcgrvsvshspttltr