PDB entry 1pfr

View 1pfr on RCSB PDB site
Description: ribonucleoside-diphosphate reductase 1 beta chain
Class: reductase
Keywords: reductase, oxidoreductase, DNA replication, iron, acting on ribose 2'-oh
Deposited on 1996-12-03, released 1997-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.179
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein r2 of ribonucleotide reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69924 (0-339)
      • engineered (210)
    Domains in SCOPe 2.07: d1pfra_
  • Chain 'B':
    Compound: protein r2 of ribonucleotide reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69924 (0-339)
      • engineered (210)
    Domains in SCOPe 2.07: d1pfrb_
  • Heterogens: FE, HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pfrA (A:)
    ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
    dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
    sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
    tvtvslrelkkklylclmsvnaleairfyvafacsfafaerelmegnakiirliardeal
    hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
    kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pfrB (B:)
    ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
    dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
    sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
    tvtvslrelkkklylclmsvnaleairfyvafacsfafaerelmegnakiirliardeal
    hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
    kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlv