PDB entry 1pfj

View 1pfj on RCSB PDB site
Description: Solution structure of the N-terminal PH/PTB domain of the TFIIH P62 subunit
Class: transcription
Keywords: PH/PTB domain, Structural Proteomics in Europe, SPINE, Structural Genomics, TRANSCRIPTION
Deposited on 2003-05-27, released 2004-06-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TFIIH basal transcription factor complex p62 subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: GTF2H1 OR BTF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1pfja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pfjA (A:)
matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispegk
akiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan