PDB entry 1pfd

View 1pfd on RCSB PDB site
Description: the solution structure of high plant parsley [2fe-2s] ferredoxin, nmr, 18 structures
Deposited on 1998-05-05, released 1999-05-11
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-11, with a file datestamp of 1999-05-10.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1pfd__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pfd_ (-)
  atynvklitpdgevefkcdddvyvldqaeeegidipyscragscsscagkvvsgsidqsd
  qsflddeqmdagyvltchayptsdvviethkeeeiv