PDB entry 1pfd

View 1pfd on RCSB PDB site
Description: the solution structure of high plant parsley [2fe-2s] ferredoxin, nmr, 18 structures
Class: electron transport
Keywords: [2fe-2s] ferredoxin, solution structure, paramagnetism, nuclear relaxation, electron transport
Deposited on 1998-05-05, released 1999-05-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ferredoxin
  Species: Petroselinum crispum [TaxId:4043]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7M1S1 (0-95)
  Domains in SCOPe 2.08: d1pfda_
• Heterogens: FES

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pfdA (A:)
  atynvklitpdgevefkcdddvyvldqaeeegidipyscragscsscagkvvsgsidqsd
  qsflddeqmdagyvltchayptsdvviethkeeeiv