PDB entry 1pev

View 1pev on RCSB PDB site
Description: Crystal Structure of the Actin Interacting Protein from Caenorhabditis Elegans
Class: structural protein
Keywords: BETA PROPELLER, WD40 REPEAT, ACTIN INTERACTING PROTEIN, ADF, COFILIN, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, STRUCTURAL PROTEIN
Deposited on 2003-05-22, released 2003-07-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin interacting protein 1
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: UNC-78 OR C04F6.4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1peva1, d1peva2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pevA (A:)
    msefsqtalfpslprtargtavvlgntpagdkiqycngtsvytvpvgsltdteiytehsh
    qttvaktspsgyycasgdvhgnvriwdttqtthilkttipvfsgpvkdiswdseskriaa
    vgegrerfghvflfdtgtsngnltgqaramnsvdfkpsrpfriisgsddntvaifegppf
    kfkstfgehtkfvhsvrynpdgslfastggdgtivlyngvdgtktgvfeddslknvahsg
    svfgltwspdgtkiasasadktikiwnvatlkvektipvgtriedqqlgiiwtkqalvsi
    sangfinfvnpelgsidqvryghnkaitalsssadgktlfsadaeghinswdistgisnr
    vfpdvhatmitgikttskgdlftvswddhlkvvpaggsgvdsskavanklssqplglavs
    adgdiavaacykhiaiyshgkltevpisynsscvalsndkqfvavggqdskvhvyklsga
    svsevktivhpaeitsvafsnngaflvatdqsrkvipysvannfelahtnswtfhtakva
    cvswspdnvrlatgsldnsvivwnmnkpsdhpiiikgahamssvnsviwlnettivsagq
    dsnikfwnvpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pevA (A:)
    sefsqtalfpslprtargtavvlgntpagdkiqycngtsvytvpvgsltdteiytehshq
    ttvaktspsgyycasgdvhgnvriwdttqtthilkttipvfsgpvkdiswdseskriaav
    gegrerfghvflfdtgtsngnltgqaramnsvdfkpsrpfriisgsddntvaifegppfk
    fkstfgehtkfvhsvrynpdgslfastggdgtivlyngvdgtktgvfeddslknvahsgs
    vfgltwspdgtkiasasadktikiwnvatlkvektipvgtriedqqlgiiwtkqalvsis
    angfinfvnpelgsidqvryghnkaitalsssadgktlfsadaeghinswdistgisnrv
    fpdvhatmitgikttskgdlftvswddhlkvvpaggsgvdsskavanklssqplglavsa
    dgdiavaacykhiaiyshgkltevpisynsscvalsndkqfvavggqdskvhvyklsgas
    vsevktivhpaeitsvafsnngaflvatdqsrkvipysvannfelahtnswtfhtakvac
    vswspdnvrlatgsldnsvivwnmnkpsdhpiiikgahamssvnsviwlnettivsagqd
    snikfwnvpf