PDB entry 1pea

View 1pea on RCSB PDB site
Description: amide receptor/negative regulator of the amidase operon of pseudomonas aeruginosa (amic) complexed with acetamide
Class: binding protein
Keywords: gene regulator, receptor, binding protein
Deposited on 1995-11-16, released 1996-04-03
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amidase operon
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27017
      • conflict (185)
      • conflict (262)
      • conflict (304)
      • conflict (318)
    Domains in SCOPe 2.01: d1peaa_
  • Heterogens: ACM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1peaA (A:)
    mgshqerpligllfsetgvtadiersqrygallaveqlnreggvggrpietlsqdpggdp
    dryrlcaedfirnrgvrflvgcymshtrkavmpvveradallcyptpyegfeyspnivyg
    gpapnqnsaplaaylirhygervvfigsdyiypresnhvmrhlyrqhggtvleeiyiply
    psdddlqraveriyqaradvvfstvvgtgtaelyraiarrygdgrrppiaslttseaeva
    kmesdvaegqvvvapyfssidtpasrafvqachgffpenatitawaeaaywqtlllgraa
    qaagnwrvedvqrhlydididapqgpvrverqnnhsrlssriaeidargvfqvrwqspep
    irpdpyvvvhnlddwsasmgggplp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1peaA (A:)
    pligllfsetgvtadiersqrygallaveqlnreggvggrpietlsqdpggdpdryrlca
    edfirnrgvrflvgcymshtrkavmpvveradallcyptpyegfeyspnivyggpapnqn
    saplaaylirhygervvfigsdyiypresnhvmrhlyrqhggtvleeiyiplypsdddlq
    raveriyqaradvvfstvvgtgtaelyraiarrygdgrrppiaslttseaevakmesdva
    egqvvvapyfssidtpasrafvqachgffpenatitawaeaaywqtlllgraaqaagnwr
    vedvqrhlydididapqgpvrverqnnhsrlssriaeidargvfqvrwqspepirpdpyv
    vvhnlddw