PDB entry 1pdu

View 1pdu on RCSB PDB site
Description: Ligand-binding domain of Drosophila orphan nuclear receptor DHR38
Class: hormone/growth factor receptor
Keywords: nuclear receptor, ligand-binding domain, HORMONE/GROWTH FACTOR RECEPTOR COMPLEX
Deposited on 2003-05-20, released 2003-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nuclear hormone receptor HR38
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: HR38
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49869 (12-End)
      • expression tag (11)
    Domains in SCOPe 2.07: d1pdua1, d1pdua2
  • Chain 'B':
    Compound: nuclear hormone receptor HR38
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: HR38
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pdub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pduA (A:)
    mkkghhhhhhgaislitalvrshvdttpdpscldyshyeeqsmseadkvqqfyqlltssv
    dvikqfaekipgyfdllpedqellfqsaslelfvlrlayrariddtklifcngtvlhrtq
    clrsfgewlndimefsrslhnleidisafaclcaltliterhglrepkkveqlqmkiigs
    lrdhvtynaeaqkkqhyfsrllgklpelrslsvqglqrifylkledlvpapalienmfvt
    tlpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pduA (A:)
    aislitalvrshvdttpdpscldyshyeeqsmseadkvqqfyqlltssvdvikqfaekip
    gyfdllpedqellfqsaslelfvlrlayrariddtklifcngtvlhrtqclrsfgewlnd
    imefsrslhnleidisafaclcaltliterhglrepkkveqlqmkiigslrdhvtynaea
    qkkqhyfsrllgklpelrslsvqglqrifylkledlvpapalienmfvtt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pduB (B:)
    mkkghhhhhhgaislitalvrshvdttpdpscldyshyeeqsmseadkvqqfyqlltssv
    dvikqfaekipgyfdllpedqellfqsaslelfvlrlayrariddtklifcngtvlhrtq
    clrsfgewlndimefsrslhnleidisafaclcaltliterhglrepkkveqlqmkiigs
    lrdhvtynaeaqkkqhyfsrllgklpelrslsvqglqrifylkledlvpapalienmfvt
    tlpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pduB (B:)
    islitalvrshvdttpdpscldyshyeeqsmseadkvqqfyqlltssvdvikqfaekipg
    yfdllpedqellfqsaslelfvlrlayrariddtklifcngtvlhrtqclrsfgewlndi
    mefsrslhnleidisafaclcaltliterhglrepkkveqlqmkiigslrdhvtynaeaq
    kkqhyfsrllgklpelrslsvqglqrifylkledlvpapalienmfvt