PDB entry 1pdn

View 1pdn on RCSB PDB site
Description: crystal structure of a paired domain-dna complex at 2.5 angstroms resolution reveals structural basis for pax developmental mutations
Deposited on 1995-05-16, released 1995-07-31
The last revision prior to the SCOP 1.59 freeze date was dated 1995-07-31, with a file datestamp of 1995-08-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.234
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Domains in SCOP 1.59: d1pdnc_

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pdnC (C:)
    qgrvnqlggvfingrplpnnirlkivemaadgirpcvisrqlrvshgcvskilnryqetg
    sirpgviggskpriatpeienrieeykrsspgmfsweirekliregvcdrstapsvsais
    rlv