PDB entry 1pd2

View 1pd2 on RCSB PDB site
Description: crystal structure of hematopoietic prostaglandin d synthase complex with glutathione
Class: ligase
Keywords: hematopoietic prostaglandin d synthase, pgds, gst, sigma-class gst, ligase
Deposited on 1998-12-14, released 1999-10-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: hematopoietic prostaglandin d synthase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pd211, d1pd212
  • Chain '2':
    Compound: hematopoietic prostaglandin d synthase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pd221, d1pd222
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pd21 (1:)
    mpnykllyfnmrgraeiiryifayldikyedhrieqadwpkikptlpfgkipvleveglt
    lhqslaiaryltkntdlagkteleqcqvdavvdtlddfmslfpwaeenqdlkertfndll
    trqaphllkdldtylgdkewfignyvtwadfywdicsttllvlkpdllgiyprlvslrnk
    vqaipaisawilkrpqtkl
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pd22 (2:)
    mpnykllyfnmrgraeiiryifayldikyedhrieqadwpkikptlpfgkipvleveglt
    lhqslaiaryltkntdlagkteleqcqvdavvdtlddfmslfpwaeenqdlkertfndll
    trqaphllkdldtylgdkewfignyvtwadfywdicsttllvlkpdllgiyprlvslrnk
    vqaipaisawilkrpqtkl