PDB entry 1pd2

View 1pd2 on RCSB PDB site
Description: crystal structure of hematopoietic prostaglandin d synthase complex with glutathione
Deposited on 1998-12-14, released 1999-10-13
The last revision prior to the SCOP 1.61 freeze date was dated 1999-10-13, with a file datestamp of 1999-10-12.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pd21 (1:)
    mpnykllyfnmrgraeiiryifayldikyedhrieqadwpkikptlpfgkipvleveglt
    lhqslaiaryltkntdlagkteleqcqvdavvdtlddfmslfpwaeenqdlkertfndll
    trqaphllkdldtylgdkewfignyvtwadfywdicsttllvlkpdllgiyprlvslrnk
    vqaipaisawilkrpqtkl
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pd22 (2:)
    mpnykllyfnmrgraeiiryifayldikyedhrieqadwpkikptlpfgkipvleveglt
    lhqslaiaryltkntdlagkteleqcqvdavvdtlddfmslfpwaeenqdlkertfndll
    trqaphllkdldtylgdkewfignyvtwadfywdicsttllvlkpdllgiyprlvslrnk
    vqaipaisawilkrpqtkl