PDB entry 1pco

View 1pco on RCSB PDB site
Description: solution structure of porcine pancreatic procolipase as determined from 1h homonuclear two-and three-dimensional nmr
Class: lipase protein cofactor
Keywords: lipase protein cofactor
Deposited on 1994-06-08, released 1994-12-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: porcine pancreatic procolipase b
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pcoa1, d1pcoa2
  • Heterogens: OH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pcoA (A:)
    vpdprgiiinldegelclnsaqcksnccqhdtilslsrcalkarensecsaftlygvyyk
    cpcergltcegdkslvgsitntnfgichnvgrs