PDB entry 1pc2

View 1pc2 on RCSB PDB site
Description: Solution structure of human mitochondria fission protein Fis1
Class: unknown function
Keywords: Mitochondria, Fission, UNKNOWN FUNCTION
Deposited on 2003-05-15, released 2003-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: mitochondria fission protein
  Species: Homo sapiens [TaxId:9606]
  Gene: Fis1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y3D6 (0-144)
    • expression tag (145-151)
  Domains in SCOPe 2.07: d1pc2a1, d1pc2a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pc2A (A:)
  meavlnelvsvedllkfekkfqsekaagsvskstqfeyawclvrskynddirkgivllee
  llpkgskeeqrdyvfylavgnyrlkeyekalkyvrgllqtepqnnqakelerlidkamkk
  dglvgmaivggmalgvaglagliglehhhhhh