PDB entry 1pbx

View 1pbx on RCSB PDB site
Description: haemoglobin of the antarctic fish pagothenia bernacchii: amino acid sequence, oxygen equilibria and crystal structure of its carbonmonoxy derivative
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1991-11-04, released 1992-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.178
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin (carbonmonoxy) (alpha chain)
    Species: Trematomus bernacchii [TaxId:40690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pbxa_
  • Chain 'B':
    Compound: hemoglobin (carbonmonoxy) (beta chain)
    Species: Trematomus bernacchii [TaxId:40690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pbxb_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pbxA (A:)
    slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
    kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pbxB (B:)
    vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
    aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
    aftaetqgafqkflavvvsalgkqyh