PDB entry 1pau

View 1pau on RCSB PDB site
Description: crystal structure of the complex of apopain with the tetrapeptide aldehyde inhibitor ac-devd-cho
Deposited on 1996-06-06, released 1997-07-07
The last revision prior to the SCOP 1.59 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.195
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1pau.1
  • Chain 'B':
    Domains in SCOP 1.59: d1pau.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pauA (A:)
    dnsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnkndltr
    eeivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrcrsltg
    kpklfiiqacrgteldcgie
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pauB (B:)
    kipveadflyaystapgyyswrnskdgswfiqslcamlkqyadklefmhiltrvnrkvat
    efesfsfdatfhakkqipcivsmltkelyfy