PDB entry 1pa4

View 1pa4 on RCSB PDB site
Description: Solution structure of a putative ribosome-binding factor from Mycoplasma pneumoniae (MPN156)
Class: structural genomics, unknown function
Keywords: Ribosome-binding Factor, Structural Genomics, Distant Homology, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, UNKNOWN FUNCTION
Deposited on 2003-05-13, released 2004-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ribosome-binding factor A
    Species: Mycoplasma pneumoniae [TaxId:2104]
    Gene: MPN156
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pa4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pa4A (A:)
    masykkerlendiirlinrtviheiynetvktghvthvklsddllhvtvyldcynreqid
    rvvgafnqakgvfsrvlahnlylakavqihfvkdkaidnamriesiinslkkskpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pa4A (A:)
    kerlendiirlinrtviheiynetvktghvthvklsddllhvtvyldcynreqidrvvga
    fnqakgvfsrvlahnlylakavqihfvkdkaidnam