PDB entry 1pa4
View 1pa4 on RCSB PDB site
Description: Solution structure of a putative ribosome-binding factor from Mycoplasma pneumoniae (MPN156)
Class: structural genomics, unknown function
Keywords: Ribosome-binding Factor, Structural Genomics, Distant Homology, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, UNKNOWN FUNCTION
Deposited on
2003-05-13, released
2004-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Probable ribosome-binding factor A
Species: Mycoplasma pneumoniae [TaxId:2104]
Gene: MPN156
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1pa4a_
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1pa4A (A:)
masykkerlendiirlinrtviheiynetvktghvthvklsddllhvtvyldcynreqid
rvvgafnqakgvfsrvlahnlylakavqihfvkdkaidnamriesiinslkkskpn
Sequence, based on observed residues (ATOM records): (download)
>1pa4A (A:)
kerlendiirlinrtviheiynetvktghvthvklsddllhvtvyldcynreqidrvvga
fnqakgvfsrvlahnlylakavqihfvkdkaidnam